PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun008341
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB
Protein Properties Length: 273aa    MW: 30689.2 Da    PI: 4.8512
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-2846PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.7e-151763248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +WT+eEd++l++ +   G  +W+++++  g++R++k+c++rw +yl
        Vun008341 17 SPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 63
                     58*******************************************97 PP

2Myb_DNA-binding53.36.3e-1772113447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       T+ E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
        Vun008341  72 LTQAEEQLVIDLHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 113
                      699****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.133763IPR017930Myb domain
SMARTSM007175.4E-111565IPR001005SANT/Myb domain
PfamPF002496.6E-141763IPR001005SANT/Myb domain
SuperFamilySSF466891.42E-2517110IPR009057Homeodomain-like
CDDcd001675.90E-91863No hitNo description
Gene3DG3DSA:1.10.10.604.1E-191870IPR009057Homeodomain-like
PROSITE profilePS5129427.51364118IPR017930Myb domain
SMARTSM007174.3E-1568116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-2571118IPR009057Homeodomain-like
PfamPF002494.8E-1572113IPR001005SANT/Myb domain
CDDcd001672.19E-1173114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
XLVWGGNPAV KTWGEESPWT AEEDKKLINF ILTNGQCCWR AVPKLAGLRR CGKSCRLRWT  60
NYLRPDLKRG LLTQAEEQLV IDLHARLGNR WSKIAARLPG RTDNEIKNHW NTHIKKKLLK  120
MGIDPVTHEP LNKQATSQDS SPSPSEHLPQ PENNLDQVKE TDVVLNSEEN SSSSQAENSS  180
GDDSLLLDSI CSDDSLLNTL WLDETPLMEA LWDTTPKLEN NTNSNMGFGT ILGGQLCLVI  240
GLQDFGIHDF GFNCFNEIES NALHTIEMKD EEH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-27161187108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014509393.11e-159PREDICTED: protein ODORANT1
SwissprotQ50EX65e-93ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0S3R5P81e-158A0A0S3R5P8_PHAAN; Uncharacterized protein
TrEMBLA0A0L9TPY61e-158A0A0L9TPY6_PHAAN; Uncharacterized protein
STRINGGLYMA01G42050.11e-138(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.12e-79myb domain protein 85